Feinbergwaller.com

Feinberg & Waller is a results-oriented law firm that practices exclusively in family law. We serve clients in Los Angeles and Ventura counties: 800-655-4766.

Popularity: Safety: Legit: legal Contact info: Contact page
advertising

Feinbergwaller.com Domain Statistics

Title:
Los Angeles Divorce Lawyer | Family Law | Child Custody Attorneys
Description:
Feinberg & Waller is a results-oriented law firm that practices exclusively in family law. We serve clients in Los Angeles and Ventura counties: 800-6... more
SEO score:
30%
Website Worth:
$2,141 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Webstatsdomain backlinks:
IP-address:
104.96.220.137
Date Registered
1999-07-07 04:00:00
Expires
2013-07-07 04:00:00
Site Age
24 years and 9 months
Owner
Metropolitan Collegiate Hockey Confference ( Edelman Lance )
Pageviews per User:
2
Daily Pageviews:
n\a
Sites redirect to this site:
beverlyhillsdivorcelawyersite.com, californiasamesexmarriageattorney.com, bakersfieldcaliforniadivorcelawyer.com, californiapremaritalagreement.com, lectriclaw.com, losangelescertifiedfamilylawspecialist.com, losangelescertifiedfamilyspecialist.com, losangelessamesexmarriageattorney.com, losangelessamesexmarriagelawyer.com, losangelesdivorceattorneynow.com, losangelesdivorceattorneytoday.com, losangelesdivorcelawyertoday.com, losangelesdivorcesite.com, losangelesdivorcetoday.com, mybeverlyhillsdivorceattorney.com, mysanfernandovalleydivorcelawyer.com, sanfernandovalleyfamilylawblog.com, sanfernandovalleydivorceattorneysite.com, sanfernandovalleydivorcelawyersite.com, santamonicadivorceattorneytoday.com, thebeverlyhillsdivorceattorney.com, thebeverlyhillsdivorcelawyer.com, thelosangelesdivorce.com, thelosangelesdivorceattorney.com, thelosangelesdivorcelawyer.com, thelosangelesfamilylawblog.com, thesanfernandovalleydivorceattorney.com, thesanfernandovalleydivorcelawyer.com, thesantamonicadivorceattorney.com, thewestlosangelesdivorceattorney.com, thewestsidelosangelesdivorceattorney.com, thewestsidelosangelesdivorcelawyer.com, westlosangelesdivorceattorney.com, westlosangelesdivorceattorneysite.com, westsidelosangelesdivorceattorney.com, westsidelosangelesdivorceattorneysite.com, westsidelosangelesdivorcelawyer.com, westsidelosangelesdivorcelawyernow.com, westsidelosangelesdivorcelawyersite.com, www.thecaliforniafamilylawblog.com more (40)
Load Time:
0.02 seconds
advertising

Feinbergwaller.com competitors

 

San Antonio Family Law & Divorce Lawyer | Bexar County tx Child Custody Lawyer...

Contact rebecca gonzalez in san antonio, texas, at 210 - 888 - 9836 or toll free at 800 - 823 - 6321 for a

| | www.rebeccagonzalezlawfirm.com

 

Fort Worth Family Law Attorney - Divorce - Cps - Child Custody...

The law office of william d.pruett, pllc is a family law attorney serving fort worth texas

| | thecowtownlawyer.com

 

Renee M.marcelle - Marin Family Law Attorney Marin County Family Lawlawyer...

Marin county divorce lawyer, renee m.marcelle, also practices as a family law attorney

| | familylawmarin.com

 

Tustin Divorce Attorney | Southern California Family Law Lawyer...

Facing divorce or any other family law issue? a tustin family law attorney at the law offices of kris

| | www.familylawoc.net

 

Welcome to Orange County Family Lawyer, Family Law Attorney Near Santaana 92705...

Orange county family lawyer, family law attorney near santa ana 92705, family law attorney orange county ca

| | www.ocfamilylawattorneys.com

 

Divorce And Child Custody Lawyer | Family Law Attorney in Austin, tx

Call 512 - 472 - 4040 for a board - certified family law attorney with 20 - plus years of experience.weinman

| | www.weinmanfamilylaw.com

 

Denton Divorce Attorney | Family Law Lawyer | Child Custody

Experienced family law attorney serving denton, flower mound, lewisville, highland village, little elm

| | oconnellfirm.com

 

Chino Hills Family Law Attorney | Riverside County Divorce Lawyer...

Chino hills family law attorney.the law offices of rossana mitchell.initial consultations.call 888

| | www.rossanamitchell.com

 

Divorce & Family Law Attorney Dallas | Child Custody & Support Lawyerdenton County...

To schedule a free consultation with an experienced dallas, texas, divorce and family law attorney

| | www.dallasfamilylawattorney.com

Feinbergwaller.com Sites with a similar domain name

We found 18 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

Sports Medicine Long Beach, ca - Chiropractor Long Beach, ca

Feinberg chiropractic provides chiropractor solutions in long beach, ca and throughout southern california - currently operating out of zarzana chiropractic

| | feinbergchiropractic.com

 

Feinberg Consulting Services | Feinberg Consulting, Inc.

Founded in 1996, feinberg consulting provides catastrophic case management, addiction recovery services and bridgeway home care

| | feinbergconsulting.com

 

Home

Make it happen. Every day, we help entrepreneurs close the deals they need to succeed. Our legal and business advice is straightforward and our commitment is personal

| | feinberghanson.com

 

Boston Accident Injury Lawyers | Feinberg & Alban pc

If you or a loved one has suffered an injury from an accident in the boston area, contact feinberg & alban pc for aggressive representation

| | feinbergalban.com

 

Lawyers, Illinois Divorce Lawyer, Attorneys

Feinberg & barry p.c. Divorce lawyers in illinois know that to meet each client's needs and provide excellent legal guidance, our thorough understanding of legal, tax, and business matters as well as the emotional issues must be imparted to our c

| | feinbergbarry.com

 

Feinbergcapital.com

| | feinbergcapital.com

 

Cece Feinberg Public Relations

Cece feinberg public relations is a full-service agency specializing in national consumer media placement, brand building and event management

| | feinbergpr.com

 

Home | Feinberg & Kamholtz

Massachusetts family law, criminal defense, civil litigation and appeals lawyers, a reputation for professional excellence, , feinberg & kamholtz is a small

| | feinberg-kamholtz.com

 

Page Not Found

| | feinbergpark.com

 

Intro Welcome to Feinberg & Company

Feinberg & company are certified public accountants that specialize in financial advice, management and tax services

| | feinbergcpa.com

 

Dreamhost

| | feinbergworldwide.com

 

Feinberg Law Office

Insert description here

| | feinberglaw.com

 

Feinberg Shopp Associates

Feinberg shopp associates is a pennsylvania-based healthcare consulting and government relations firm

| | feinbergshopp.com

 

Under Construction

| | feinberglawgroup.com

 

Feinberg Medical Group

Feinberg medical group offers work related injury treatment and functional restoration. our providers specialize in chronic pain management and are committed to quality patient care, patient independent self management, and return to work

| | feinbergmedicalgroup.com

 

Feinberg Consulting

| | feinberg-consulting.com

Feinbergwaller.com Domain Info

Domain Name: feinbergwaller.com
Domain Age: 24 years and 9 months
See feinbergwaller.com whois information

Feinbergwaller.com Contact information :

http://feinbergwaller.com/CM/Custom/Contact.asp - Contact Us | Divorce Attorney | Family Law Lawyer | Los Angeles, California | CA | Calabasas | Beverly Hills | Feinberg & Waller
See feinbergwaller.com contact information in whois record

Web Safety

feinbergwaller.com is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Feinbergwaller.com Visitors Localization

Traffic Estimations Low
Traffic Rank 7,820,545th most visited website in the World

Website categories

Currently, we found 18 categories on feinbergwaller.com
los angeles divorce lawyer 22 sites family law 20'750 sites
child custody 5'910 sites prenuptial agreement 201 sites
prenup 208 sites law firm 45'441 sites
Show more

Feinbergwaller.com Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
divorce lawyer malibu
6 2016-01-13
family divorce lawyer beverly hills
7 2016-02-13
divorce attorney beverly hills ca
8 2016-02-13
divorce attorney beverly hills
8 2016-01-22
feinberg law group washington dc
8 2016-01-16
feinberg law firm oakland
8 2016-01-16
divorce lawyer beverly hills
9 2016-02-13
family law attorney beverly hills
9 2015-12-30
divorce lawyers military
11 2016-01-13
divorce lawyer santa monica
13 2016-02-02

Feinbergwaller.com Anchors Cloud

Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"

  • <a>image</a>( 28% )
  • feinberg & waller( 28% )
  • family law attorney los angeles( 6% )
  • http://www.feinbergwaller.com( 6% )
  • los angeles divorce lawyer( 6% )
  • los angeles divorce attorneys( 6% )
  • marshall waller( 6% )
  • mary ellen waller( 4% )
  • divorce lawyer los angeles( 4% )
  • los angeles divorce attorney( 4% )

Feinbergwaller.com Terms Cloud

List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"

  • los( 17% )
  • angeles( 17% )
  • divorce( 13% )
  • waller( 10% )
  • attorney( 6% )
  • lawyer( 6% )
  • <a>image</a>( 3% )
  • feinberg( 3% )
  • family( 3% )
  • law( 3% )
  • attorneys( 3% )
  • marshall( 3% )
  • mary( 3% )
  • ellen( 3% )

Feinbergwaller.com Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 0.02. The highest load time is 0.04, the lowest load time is 0.01, the average load time is 0.02.

Whois Lookup For feinbergwaller.com

0reviews

Add review